PDB entry 3nkz

View 3nkz on RCSB PDB site
Description: The crystal structure of a flagella protein from Yersinia enterocolitica subsp. enterocolitica 8081
Deposited on 2010-06-21, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.158
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar protein FliT
    Species: Yersinia enterocolitica subsp. enterocolitica [TaxId:393305]
    Gene: fliT, YE2526
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1JSR8 (3-End)
      • expression tag (0-2)
  • Chain 'B':
    Compound: Flagellar protein FliT
    Species: Yersinia enterocolitica subsp. enterocolitica [TaxId:393305]
    Gene: fliT, YE2526
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1JSR8 (3-End)
      • expression tag (0-2)
  • Chain 'C':
    Compound: Flagellar protein FliT
    Species: Yersinia enterocolitica subsp. enterocolitica [TaxId:393305]
    Gene: fliT, YE2526
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1JSR8 (3-End)
      • expression tag (0-2)
  • Chain 'D':
    Compound: Flagellar protein FliT
    Species: Yersinia enterocolitica subsp. enterocolitica [TaxId:393305]
    Gene: fliT, YE2526
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1JSR8 (3-End)
      • expression tag (0-2)
  • Heterogens: SO4, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nkzA (A:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdlvgqstkqqavnntygqfpdhalllg
    etq
    

    Sequence, based on observed residues (ATOM records):
    >3nkzA (A:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdlvg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nkzB (B:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdlvgqstkqqavnntygqfpdhalllg
    etq
    

    Sequence, based on observed residues (ATOM records):
    >3nkzB (B:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdlvg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nkzC (C:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdlvgqstkqqavnntygqfpdhalllg
    etq
    

    Sequence, based on observed residues (ATOM records):
    >3nkzC (C:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nkzD (D:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdlvgqstkqqavnntygqfpdhalllg
    etq
    

    Sequence, based on observed residues (ATOM records):
    >3nkzD (D:)
    snamerhqhllseyqqiltlseqmlvlategnwdalvdlemtylkavestanitisscss
    lmlqdllreklraildneieikrllqlrldrlsdlv