PDB entry 3nkw

View 3nkw on RCSB PDB site
Description: Crystal structure of the complex of peptidoglycan recognition protein (PGRP-S) with N-acetyl glucosamine(NAG) at 2.6 A resolution
Class: immune system
Keywords: Immune response, secreted, antimicrobial, PGRP, Antibiotic, Peptidoglycan Binding, IMMUNE SYSTEM
Deposited on 2010-06-21, released 2010-07-14
Made obsolete on 2015-08-19

The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkwa_
  • Chain 'B':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkwb_
  • Chain 'C':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkwc_
  • Chain 'D':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkwd_
  • Heterogens: NAG, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nkwA (A:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nkwB (B:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nkwC (C:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nkwD (D:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra