PDB entry 3nkv

View 3nkv on RCSB PDB site
Description: Crystal structure of Rab1b covalently modified with AMP at Y77
Class: protein transport
Keywords: posttranslational modification, AMPylation, adenylylation, Rab1b, vesicular transport, PROTEIN TRANSPORT
Deposited on 2010-06-21, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B, RAB1B_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkva_
  • Chain 'B':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B, RAB1B_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkvb_
  • Heterogens: GNP, MG, BA, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nkvA (A:)
    ghmpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllv
    gnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nkvA (A:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
    dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nkvB (B:)
    ghmpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllv
    gnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nkvB (B:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasnvnkllvgnksd
    lttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrm