PDB entry 3nks

View 3nks on RCSB PDB site
Description: Structure of human protoporphyrinogen IX oxidase
Deposited on 2010-06-21, released 2011-04-20
The last revision was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protoporphyrinogen oxidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PPOX
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACJ, FAD, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nksA (A:)
    mgrtvvvlgggisglaasyhlsrapcppkvvlvesserlggwirsvrgpngaifelgprg
    irpagalgartlllvselgldsevlpvrgdhpaaqnrflyvggalhalptglrgllrpsp
    pfskplfwaglreltkprgkepdetvhsfaqrrlgpevaslamdslcrgvfagnsrelsi
    rscfpslfqaeqthrsillglllgagrtpqpdsalirqalaerwsqwslrgglemlpqal
    ethltsrgvsvlrgqpvcglslqaegrwkvslrdssleadhvisaipasvlsellpaeaa
    plaralsaitavsvavvnlqyqgahlpvqgfghlvpssedpgvlgivydsvafpeqdgsp
    pglrvtvmlggswlqtleasgcvlsqelfqqraqeaaatqlglkempshclvhlhkncip
    qytlghwqklesarqfltahrlpltlagasyegvavndciesgrqaavsvlgtepns
    

    Sequence, based on observed residues (ATOM records):
    >3nksA (A:)
    grtvvvlgggisglaasyhlsrapcppkvvlvesserlggwirsvrgpngaifelgprgi
    rpagalgartlllvselgldsevlpvrgdhpaaqnrflyvggalhalptglrgpsppfsk
    plfwaglreltkprgkepdetvhsfaqrrlgpevaslamdslcrgvfagnsrelsirscf
    pslfqaeqthrsillglllgqpdsalirqalaerwsqwslrgglemlpqalethltsrgv
    svlrgqpvcglslqaegrwkvslrdssleadhvisaipasvlsellpaeaaplaralsai
    tavsvavvnlqyqgahlpvqgfghlvpssedpgvlgivydsvafpeqdgsppglrvtvml
    ggswlqtleasgcvlsqelfqqraqeaaatqlglkempshclvhlhkncipqytlghwqk
    lesarqfltahrlpltlagasyegvavndciesgrqaavsvlgte