PDB entry 3nkr

View 3nkr on RCSB PDB site
Description: crystal structure of mouse autotaxin in complex with 22:6-lpa
Deposited on 2010-06-20, released 2011-01-19
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
    Species: Mus musculus [TaxId:10090]
    Gene: Enpp2, Npps2, Pdnp2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, BMA, MAN, ZN, CA, NA, K, NKR, SCN, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nkrA (A:)
    aewdegpptvlsdspwtntsgsckgrcfelqevgppdcrcdnlcksysscchdfdelclk
    targwectkdrcgevrneenachcsedclsrgdcctnyqvvckgeshwvdddceeirvpe
    cpagfvrppliifsvdgfrasymkkgskvmpnieklrscgthapymrpvyptktfpnlyt
    latglypeshgivgnsmydpvfdatfhlrgrekfnhrwwggqplwitatkqgvragtffw
    svsipherriltilqwlslpdnerpsvyafyseqpdfsghkygpfgpemtnplreidktv
    gqlmdglkqlklhrcvnvifvgdhgmedvtcdrteflsnyltnvdditlvpgtlgrirpk
    ipnnlkydpkaiianltckkpdqhfkpymkqhlpkrlhyannrriedlhllverrwhvar
    kpldvykkpsgkcffqgdhgfdnkvnsmqtvfvgygptfkyrtkvppfenielynvmcdl
    lglkpapnngthgslnhllrtntfrptlpeevsrpnypgimylqsdfdlgctcddknkle
    elnkrlhtkgsteerhllygrpavlyrtsydilyhtdfesgyseiflmplwtsytiskqa
    evssipehltncvrpdvrvspgfsqnclaykndkqmsygflfppylssspeakydaflvt
    nmvpmypafkrvwtyfqrvlvkkyaserngvnvisgpifdynynglrdiedeikqyvegs
    sipvpthyysiitscldftqpadkcdgplsvssfilphrpdndescnssedeskwveelm
    kmhtarvrdiehltgldfyrktsrsyseiltlktylhtyeseisrenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >3nkrA (A:)
    wtntsgsckgrcfelqevgppdcrcdnlcksysscchdfdelclktargwectkdrcgev
    rneenachcsedclsrgdcctnyqvvckgeshwvdddceeirvpecpagfvrppliifsv
    dgfrasymkkgskvmpnieklrscgthapymrpvyptktfpnlytlatglypeshgivgn
    smydpvfdatfhlrgrekfnhrwwggqplwitatkqgvragtffwsvsipherriltilq
    wlslpdnerpsvyafyseqpdfsghkygpfgpemtnplreidktvgqlmdglkqlklhrc
    vnvifvgdhgmedvtcdrteflsnyltnvdditlvpgtlgrirpkipnnlkydpkaiian
    ltckkpdqhfkpymkqhlpkrlhyannrriedlhllverrwhvarkplcffqgdhgfdnk
    vnsmqtvfvgygptfkyrtkvppfenielynvmcdllglkpapnngthgslnhllrtntf
    rptlpeevsrpnypgimylqsdfdlgctcdteerhllygrpavlyrtsydilyhtdfesg
    yseiflmplwtsytiskqaevssipehltncvrpdvrvspgfsqnclaykndkqmsygfl
    fppylssspeakydaflvtnmvpmypafkrvwtyfqrvlvkkyaserngvnvisgpifdy
    nynglrdiedeikqyvegssipvpthyysiitscldftqpadkcdgplsvssfilphrpd
    ndescnssedeskwveelmkmhtarvrdiehltgldfyrktsrsyseiltlktylhtye