PDB entry 3nkl

View 3nkl on RCSB PDB site
Description: Crystal Structure of UDP-D-Quinovosamine 4-Dehydrogenase from Vibrio fischeri
Deposited on 2010-06-20, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-D-quinovosamine 4-dehydrogenase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_0197
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E8F4 (3-End)
      • expression tag (2)
  • Chain 'B':
    Compound: UDP-D-quinovosamine 4-dehydrogenase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_0197
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E8F4 (3-End)
      • expression tag (2)
  • Heterogens: SO4, GOL, ACY, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nklA (A:)
    snakkkvliygagsaglqlanmlrqgkefhpiafidddrkkhkttmqgitiyrpkylerl
    ikkhcistvllavpsasqvqkkviieslaklhvevltipnlddlvngklsigqlkevsid
    dllgrvavtpqaelmeanikd
    

    Sequence, based on observed residues (ATOM records):
    >3nklA (A:)
    akkkvliygagsaglqlanmlrqgkefhpiafidddrkkhkttmqgitiyrpkylerlik
    khcistvllavpsasqvqkkviieslaklhvevltipnlddlvngklsigqlkevsiddl
    lg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nklB (B:)
    snakkkvliygagsaglqlanmlrqgkefhpiafidddrkkhkttmqgitiyrpkylerl
    ikkhcistvllavpsasqvqkkviieslaklhvevltipnlddlvngklsigqlkevsid
    dllgrvavtpqaelmeanikd
    

    Sequence, based on observed residues (ATOM records):
    >3nklB (B:)
    akkkvliygagsaglqlanmlrqgkefhpiafidddrkkhkttmqgitiyrpkylerlik
    khcistvllavpsasqvqkkviieslaklhvevltipnlddlvngklsigqlkevsiddl
    lgr