PDB entry 3nkk

View 3nkk on RCSB PDB site
Description: Trypsin in complex with fluorine containing fragment
Class: hydrolase
Keywords: beta barrel, chymotrypsin, chymotrypsin double beta barrel, peptide hydrolase, Calcium binding, pancreas-duodenum, HYDROLASE
Deposited on 2010-06-20, released 2010-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.132
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cationic trypsin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.05: d3nkka_
• Heterogens: DMS, CA, JLZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3nkkA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn