PDB entry 3nkh

View 3nkh on RCSB PDB site
Description: Crystal Structure of Integrase from MRSA strain Staphylococcus aureus
Deposited on 2010-06-19, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.158
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Staphylococcus aureus subsp. aureus USA300_TCH1516 [TaxId:451516]
    Gene: USA300HOU_0850
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8Z1E8 (24-243)
      • expression tag (20-23)
  • Chain 'B':
    Compound: integrase
    Species: Staphylococcus aureus subsp. aureus USA300_TCH1516 [TaxId:451516]
    Gene: USA300HOU_0850
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8Z1E8 (24-243)
      • expression tag (19-23)
  • Heterogens: CL, SO4, MRD, MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nkhA (A:)
    mhhhhhhssgvdlgtenlyfqsnaylelneiesiikdintkaqkmhsgihkrfylfvalm
    tefqalngmrigemlaiqnedidfdnkslningtihwfhdesggfgvkdttktessyrti
    glssrsceilkkailenkkdskwndgylnrnfvftnhkgnpmqterfnkilreaakdvgi
    dkevsshilrhshisllsqqgvslkaimdrvghsdhrttlsiyshvteqmdkdmmnkleq
    vklg
    

    Sequence, based on observed residues (ATOM records):
    >3nkhA (A:)
    qsnaylelneiesiikdintkaqkmhsgihkrfylfvalmtefqalngmrigemlaiqne
    didfdnkslningtihwfhdesggfgvkdttssyrtiglssrsceilkkailenkkdskw
    ndgylnrnfvftnhkgnpmqterfnkilreaakdvgidkevsshilrhshisllsqqgvs
    lkaimdrvghsdhrttlsiyshvteqmdkdmmnkleqvklg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nkhB (B:)
    mhhhhhhssgvdlgtenlyfqsnaylelneiesiikdintkaqkmhsgihkrfylfvalm
    tefqalngmrigemlaiqnedidfdnkslningtihwfhdesggfgvkdttktessyrti
    glssrsceilkkailenkkdskwndgylnrnfvftnhkgnpmqterfnkilreaakdvgi
    dkevsshilrhshisllsqqgvslkaimdrvghsdhrttlsiyshvteqmdkdmmnkleq
    vklg
    

    Sequence, based on observed residues (ATOM records):
    >3nkhB (B:)
    fqsnaylelneiesiikdintkaqkmhsgihkrfylfvalmtefqalngmrigemlaiqn
    edidfdnkslningtihwfhdesggfgvkdttktessyrtiglssrsceilkkailenkk
    dskwndgylnrnfvftnhkgnpmqterfnkilreaakdvgidkevsshilrhshisllsq
    qgvslkaimdrvghsdhrttlsiyshvteqmdkdmmnkleqvklg