PDB entry 3nkg

View 3nkg on RCSB PDB site
Description: Crystal Structure of GEBA250068378 from Sulfurospirillum deleyianum
Deposited on 2010-06-19, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein GEBA250068378
    Species: Sulfurospirillum deleyianum [TaxId:525898]
    Gene: Sdel_1248
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1B2F0 (3-End)
      • expression tag (2)
  • Chain 'B':
    Compound: uncharacterized protein GEBA250068378
    Species: Sulfurospirillum deleyianum [TaxId:525898]
    Gene: Sdel_1248
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1B2F0 (3-End)
      • expression tag (2)
  • Heterogens: ACY, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nkgA (A:)
    snapnpisipidlsqagsvvekevkieeswsyhlilqfavhdrkedggldgkrvwkflgf
    nsydprdgkqvgyvdyrlakselgdlidetydcdgtvvpikitihqinqdntkkliadnl
    ymtkgngsgaytrdittisldkgkyifrienieafsemigrkvdftiyinkrdk
    

    Sequence, based on observed residues (ATOM records):
    >3nkgA (A:)
    apnpisipidlsqagsvvekevkieeswsyhlilqfavhdrkedggldgkrvwkflgfns
    ydprdgkqvgyvdyrlakselgdlidetydcdgtvvpikitihqinqdntkkliadnlym
    tkgngsgaytrdittisldkgkyifrienieafsemigrkvdftiyinkr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nkgB (B:)
    snapnpisipidlsqagsvvekevkieeswsyhlilqfavhdrkedggldgkrvwkflgf
    nsydprdgkqvgyvdyrlakselgdlidetydcdgtvvpikitihqinqdntkkliadnl
    ymtkgngsgaytrdittisldkgkyifrienieafsemigrkvdftiyinkrdk
    

    Sequence, based on observed residues (ATOM records):
    >3nkgB (B:)
    apnpisipidlsqagsvvekevkieeswsyhlilqfavhdrkedggldgkrvwkflgfns
    ydprdgkqvgyvdyrlakselgdlidetydcdgtvvpikitihqinqdntkkliadnlym
    tkgngsgaytrdittisldkgkyifrienieafsemigrkvdftiyinkr