PDB entry 3nkf

View 3nkf on RCSB PDB site
Description: Crystal structure of human ligand-free mature caspase-6 with intersubunit linker attached
Deposited on 2010-06-18, released 2010-12-08
The last revision was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caspase-6
    Species: synthetic, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Caspase-6
    Species: synthetic, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Caspase-6
    Species: synthetic, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55212 (Start-270)
      • expression tag (271)
  • Chain 'D':
    Compound: Caspase-6
    Species: synthetic, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nkfA (A:)
    mafykremfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlg
    fevkcfndlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltgl
    fkgdkchslvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpa
    gadflmcysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvd
    fckdpsaigkkqvpcfasmltkklhffpksnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nkfA (A:)
    fdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfnd
    lkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchs
    lvgkpkifiiqacytlpagadflmcysvaegyyshretvngswyiqdlcemlgkygssle
    ftelltlvnrkvsqraigkkqvpcfasmltkklhffpks
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nkfB (B:)
    mafykremfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlg
    fevkcfndlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltgl
    fkgdkchslvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpa
    gadflmcysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvd
    fckdpsaigkkqvpcfasmltkklhffpksnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nkfB (B:)
    fdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfnd
    lkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchs
    lvgkpkifiiqacragadflmcysvaegyyshtvngswyiqdlcemlgkygssleftell
    tlvnrkvsqrrvdfckqvpcfasmltkklhffp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nkfC (C:)
    mafykremfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlg
    fevkcfndlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltgl
    fkgdkchslvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpa
    gadflmcysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvd
    fckdpsaigkkqvpcfasmltkklhffpksnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nkfC (C:)
    fdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfnd
    lkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchs
    lvgkpkifiiqacvytlpagadflmcysvaegyyshretvngswyiqdlcemlgkygssl
    eftelltlvnrkvsqrrvgkkqvpcfasmltkklhffpksnh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nkfD (D:)
    mafykremfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlg
    fevkcfndlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltgl
    fkgdkchslvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpa
    gadflmcysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvd
    fckdpsaigkkqvpcfasmltkklhffpksnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nkfD (D:)
    fdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfnd
    lkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchs
    lvgkpkifiiqacytlpagadflmcysvaegyyshretvngswyiqdlcemlgkygssle
    ftelltlvnrkvsqrpsaigkkqvpcfasmltkklhffpk