PDB entry 3nkd

View 3nkd on RCSB PDB site
Description: Structure of CRISP-associated protein Cas1 from Escherichia coli str. K-12
Class: immune system
Keywords: CRISPR,Cas1,YgbT,Nuclease, DNA recombination, DNA repair, IMMUNE SYSTEM
Deposited on 2010-06-18, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRISPR-associated protein Cas1
    Species: Escherichia coli [TaxId:536056]
    Gene: EcDH1_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkda_
  • Chain 'B':
    Compound: CRISPR-associated protein Cas1
    Species: Escherichia coli [TaxId:536056]
    Gene: EcDH1_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nkdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nkdA (A:)
    mtwlplnpiplkdrvsmiflqygqidvidgafvlidktgirthipvgsvacimlepgtrv
    shaavrlaaqvgtllvwvgeagvrvyasgqpggarsdkllyqaklaldedlrlkvvrkmf
    elrfgepaparrsveqlrgiegsrvratyallakqygvtwngrrydpkdwekgdtinqci
    saatsclygvteaailaagyapaigfvhtgkplsfvydiadiikfdtvvpkafeiarrnp
    gepdrevrlacrdifrssktlaklipliedvlaageiqppappedaqpvaiplpvslgda
    ghrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nkdA (A:)
    drvsmiflqygqidvidgafvlidktgirthipvgsvacimlepgtrvshaavrlaaqvg
    tllvwvgeagvrvyasgqpggarsdkllyqaklaldedlrlkvvrkmfelrfgepaparr
    sveqlrgiegsrvratyallakqygvtwngrrekgdtinqcisaatsclygvteaailaa
    gyapaigfvhtgkplsfvydiadiikfdtvvpkafeiarrnpgepdrevrlacrdifrss
    ktlaklipliedvlaageiqpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nkdB (B:)
    mtwlplnpiplkdrvsmiflqygqidvidgafvlidktgirthipvgsvacimlepgtrv
    shaavrlaaqvgtllvwvgeagvrvyasgqpggarsdkllyqaklaldedlrlkvvrkmf
    elrfgepaparrsveqlrgiegsrvratyallakqygvtwngrrydpkdwekgdtinqci
    saatsclygvteaailaagyapaigfvhtgkplsfvydiadiikfdtvvpkafeiarrnp
    gepdrevrlacrdifrssktlaklipliedvlaageiqppappedaqpvaiplpvslgda
    ghrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nkdB (B:)
    iplkdrvsmiflqygqidvidgafvlidirthipvgsvacimlepgtrvshaavrlaaqv
    gtllvwvgeagvrvyasgqpggarsdkllyqaklaldedlrlkvvrkmfelrfgepapar
    rsveqlrgiegsrvratyallakqygvtwngrrgdtinqcisaatsclygvteaailaag
    yapaigfvhtgkplsfvydiadiikfdtvvpkafeiarrnpgepdrevrlacrdifrssk
    tlaklipliedvlaageiqpp