PDB entry 3nk5

View 3nk5 on RCSB PDB site
Description: Crystal structure of AqpZ mutant F43W
Class: transport protein
Keywords: aquaporin, integral membrane protein, transport protein, selectivity filter
Deposited on 2010-06-18, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aquaporin Z
    Species: Escherichia coli [TaxId:83333]
    Gene: aqpZ, b0875, bniP, JW0859
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60844 (3-End)
      • expression tag (2)
      • engineered mutation (33)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d3nk5a1, d3nk5a2
  • Chain 'B':
    Compound: Aquaporin Z
    Species: Escherichia coli [TaxId:83333]
    Gene: aqpZ, b0875, bniP, JW0859
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60844 (3-233)
      • expression tag (1-2)
      • engineered mutation (33)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d3nk5b1, d3nk5b2
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nk5A (A:)
    ashmfrklaaecfgtfwlvfggcgsavlaagfpalgigfagvalawgltvltmafavghi
    sgghfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfa
    sngygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlis
    ipvtntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nk5A (A:)
    hmfrklaaecfgtfwlvfggcgsavlaagfpalgigfagvalawgltvltmafavghisg
    ghfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasn
    gygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisip
    vtntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtlle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nk5B (B:)
    ashmfrklaaecfgtfwlvfggcgsavlaagfpalgigfagvalawgltvltmafavghi
    sgghfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfa
    sngygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlis
    ipvtntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nk5B (B:)
    shmfrklaaecfgtfwlvfggcgsavlaagfpalgigfagvalawgltvltmafavghis
    gghfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfas
    ngygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisi
    pvtntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd