PDB entry 3nk4

View 3nk4 on RCSB PDB site
Description: crystal structure of full-length sperm receptor zp3 at 2.0 a resolution
Deposited on 2010-06-18, released 2010-11-10
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zona pellucida 3
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Zona pellucida 3
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Zona pellucida 3
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P79762 (Start-23)
      • expression tag (24-29)
  • Chain 'D':
    Compound: Zona pellucida 3
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: A2G, FLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nk4A (A:)
    ytpvavqcqeaqlvvtvhrdlfgtgrlinaadltlgpaackhsslnaahntvtfaaglhe
    cgsvvqvtpdtliyrtlinydpspasnpviirtnpavipiechyprreqvssnairptws
    pfnsalsaeerlvfslrlmsddwsterpftgfqlgdilniqaevstenhvplrlfvdscv
    aalspdgdssphyaiidfngclvdgrvddtssafitprpredvlrfridvfrfagdnrnl
    iyitchlkvtpadqgpdpqnkacsfnkarntwvpvegsrdvcnccetgnceppalsr
    

    Sequence, based on observed residues (ATOM records):
    >3nk4A (A:)
    ytpvavqcqeaqlvvtvhrdlfgtgrlinaadltlgpaackhsslnaahntvtfaaglhe
    cgsvvqvtpdtliyrtlinydpspasnpviirtnpavipiechyprptwspfnerlvfsl
    rlmsddwsterpftgfqlgdilniqaevstenhvplrlfvdscvaalspdgdssphyaii
    dfngclvdgrvddtssafitprpredvlrfridvfrfagdnrnliyitchlkvtpadqgp
    dpqnkacsfnkarntwvpvegsrdvcnccetgncepp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nk4B (B:)
    ytpvavqcqeaqlvvtvhrdlfgtgrlinaadltlgpaackhsslnaahntvtfaaglhe
    cgsvvqvtpdtliyrtlinydpspasnpviirtnpavipiechyprreqvssnairptws
    pfnsalsaeerlvfslrlmsddwsterpftgfqlgdilniqaevstenhvplrlfvdscv
    aalspdgdssphyaiidfngclvdgrvddtssafitprpredvlrfridvfrfagdnrnl
    iyitchlkvtpadqgpdpqnkacsfnkarntwvpvegsrdvcnccetgnceppalsr
    

    Sequence, based on observed residues (ATOM records):
    >3nk4B (B:)
    tpvavqcqeaqlvvtvhrdlfgtgrlinaadltlgpaackhsslnaahntvtfaaglhec
    gsvvqvtpdtliyrtlinydpspasnpviirtnpavipiechyprrlvfslrlmsddwst
    erpftgfqlgdilniqaevstenhvplrlfvdscvaalspdgdssphyaiidfngclvdg
    rvddtssafitprpredvlrfridvfrfagdnrnliyitchlkvtpadqgpdpqnkacsf
    nkarntwvpvegsrdvcnccetgncepp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nk4C (C:)
    afaadagkevaadvvigpvllsadhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nk4C (C:)
    evaadvvigpvllsadhhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nk4D (D:)
    afaadagkevaadvvigpvllsadhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nk4D (D:)
    vaadvvigpvllsa