PDB entry 3njz

View 3njz on RCSB PDB site
Description: Crystal Structure of Salicylate 1,2-dioxygenase from Pseudoaminobacter salicylatoxidans Adducts with salicylate
Class: oxidoreductase
Keywords: beta-sandwich, oxidoreductase
Deposited on 2010-06-18, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gentisate 1,2-dioxygenase
    Species: Pseudaminobacter salicylatoxidans [TaxId:93369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67FT0
      • conflict (162)
    Domains in SCOPe 2.07: d3njza_
  • Heterogens: FE2, SAL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3njzA (A:)
    mqnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwk
    wstllrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehr
    hsqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipf
    sqqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdr
    alteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgs
    tvfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfm
    rtkiegqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3njzA (A:)
    ekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwst
    llrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehrhsq
    nafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqq
    mdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralt
    eqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvf
    qvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtk
    iegq