PDB entry 3njy

View 3njy on RCSB PDB site
Description: Crystal structure of JMJD2A complexed with 5-carboxy-8-hydroxyquinoline
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: OXIDOREDUCTASE, CHROMATIN REGULATOR, TRANSCRIPTION REGULATION, DOUBLE-STRANDED BETA HELIX, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-06-18, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.182
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3njya_
  • Chain 'B':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3njyb_
  • Heterogens: NI, ZN, 8XQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3njyA (A:)
    mhhhhhhssgvdlgtenlyfqsmasesetlnpsarimtfyptmeefrnfsryiayiesqg
    ahraglakvvppkewkprasyddiddlvipapiqqlvtgqsglftqyniqkkamtvrefr
    kiansdkyctprysefeelerkywknltfnppiygadvngtlyekhvdewnigrlrtild
    lvekesgitiegvntpylyfgmwktsfawhtedmdlysinylhfgepkswysvppehgkr
    lerlakgffpgsaqsceaflrhkmtlisplmlkkygipfdkvtqeagefmitfpygyhag
    fnhgfncaestnfatrrwieygkqavlcscrkdmvkismdvfvrkfqperyklwkagkdn
    tvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3njyA (A:)
    lnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvi
    papiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltf
    nppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfaw
    htedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisp
    lmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcs
    crkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3njyB (B:)
    mhhhhhhssgvdlgtenlyfqsmasesetlnpsarimtfyptmeefrnfsryiayiesqg
    ahraglakvvppkewkprasyddiddlvipapiqqlvtgqsglftqyniqkkamtvrefr
    kiansdkyctprysefeelerkywknltfnppiygadvngtlyekhvdewnigrlrtild
    lvekesgitiegvntpylyfgmwktsfawhtedmdlysinylhfgepkswysvppehgkr
    lerlakgffpgsaqsceaflrhkmtlisplmlkkygipfdkvtqeagefmitfpygyhag
    fnhgfncaestnfatrrwieygkqavlcscrkdmvkismdvfvrkfqperyklwkagkdn
    tvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3njyB (B:)
    lnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvi
    papiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltf
    nppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfaw
    htedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisp
    lmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcs
    crkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl