PDB entry 3njx

View 3njx on RCSB PDB site
Description: Rhamnogalacturonan Lyase from Aspergillus aculeatus mutant H210A
Class: lyase
Keywords: Carbohydrate active enzyme, Lyase, Pectin degradation, Polysaccharide Lyase Family 4
Deposited on 2010-06-18, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhamnogalacturonase B
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: RHGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00019 (0-507)
      • engineered mutation (209)
    Domains in SCOPe 2.07: d3njxa1, d3njxa2, d3njxa3
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3njxA (A:)
    afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
    tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
    epfgdvsttadgtaiegsdvflvgsetrskfysserfiddqrhciagdahrvcmilnqye
    sssggpfhrdinsnnggsynalywymnsgavqtesyrmglhgpysmyfsrsgtpstsidt
    sffadldikgyvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamk
    pgtytmvyyqgeyavatssvtvsagstttknisgsvktgttifkigewdgqptgfrnaan
    qlrmhpsdsrmsswgpltytvgssaltdfpmavfksvnnpvtikftatsaqtgaatlrig
    ttlsfaggrpqatinsytgsapaaptnldsrgvtrgayrglgevydvsipsgtivagtnt
    itinvisgssgdtylspnfifdcvelfq