PDB entry 3njv

View 3njv on RCSB PDB site
Description: Rhamnogalacturonan lyase from Aspergillus aculeatus K150A substrate complex
Class: lyase
Keywords: Carbohydrate active enzyme, Lyase, Pectin degradation, Polysaccharide Lyase Family 4
Deposited on 2010-06-18, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhamnogalacturonase B
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: RHGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00019 (0-507)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d3njva1, d3njva2, d3njva3
  • Heterogens: CA, SO4, RAM, GTR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3njvA (A:)
    afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
    tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
    epfgdvsttadgtaiegsdvflvgsetrsafysserfiddqrhciagdahrvcmilnqye
    sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt
    sffadldikgyvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamk
    pgtytmvyyqgeyavatssvtvsagstttknisgsvktgttifkigewdgqptgfrnaan
    qlrmhpsdsrmsswgpltytvgssaltdfpmavfksvnnpvtikftatsaqtgaatlrig
    ttlsfaggrpqatinsytgsapaaptnldsrgvtrgayrglgevydvsipsgtivagtnt
    itinvisgssgdtylspnfifdcvelfq