PDB entry 3nju

View 3nju on RCSB PDB site
Description: Crystal structure of the complex of group I phospholipase A2 with 4-Methoxy-benzoicacid at 1.4A resolution
Class: Hydrolase
Keywords: PLA2, complex, anisic acid, Naja sagittifera, Hydrolase
Deposited on 2010-06-18, released 2010-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.177
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60045 (0-118)
      • conflict (18)
      • conflict (45)
    Domains in SCOPe 2.08: d3njua_
  • Heterogens: ANN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3njuA (A:)
    nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn