PDB entry 3njt

View 3njt on RCSB PDB site
Description: Crystal structure of the R450A mutant of the membrane protein FhaC
Deposited on 2010-06-18, released 2010-11-03
The last revision was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.35
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamentous hemagglutinin transporter protein fhaC
    Species: Bordetella pertussis [TaxId:520]
    Gene: fhaC, BP1884
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35077 (15-565)
      • expression tag (14)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njtA (A:)
    qaqgshhhhhhgpgsllpgardlnriddrqrkeqlqrdieraltrppvelnpqseaaapa
    rkpdatsghtvtvhavdldfgvegrlfdpaplvqdylnrpldneqlfllvkalsaalydr
    gyatsivtfvppgvvdgvlklkvewgrikgwlidgkplegtrdrmmvfsampgwqdkvln
    vfdidqaiyninnggktgnitivpadeygysyldlqlqrralprvslgmdnsgpgtpeng
    rykynasvtandllglndtlglyignryyrdaghdaernydlmysvplgrtrldlqtgys
    tyrnllktrygqyqsagnsrsfglkatrllyrdtrsqfsvygglklrqnknylagtrldv
    sskhysdvtvgmqystqrganayfgdlsftrgvgvnngkyaaydergpqgnvsrfngsla
    wtrymalagqpiqwasqlgfqysrqqllnsyqitvgdeytvagynlrtsqsgdsgvylsn
    tltvpvqfsllgkqasvapfvgadvgalksnhpdartirmaglaagvrfdlpyarmsfty
    skpvgaqpggaprapvwlyinaglsf
    

    Sequence, based on observed residues (ATOM records):
    >3njtA (A:)
    sllpgardlnriddrqrkeqlqrdierahavdldfgvegrlfdpaplvqdylnrpldneq
    lfllvkalsaalydrgyatsivtfvppgvvdgvlklkvewgrikgwlidgkplegtrdrm
    mvfsampgwqdkvlnvfdidqaiyninnggktgnitivpadeygysyldlqlqrralprv
    slgmdnsrykynasvtandllglndtlglyignryyrdaghdaernydlmysvplgrtrl
    dlqtgystyrnllqsagnsrsfglkatrllyrdtrsqfsvygglklrqnknylkhysdvt
    vgmqystqrganayfgdlsftrgvgvgnvsrfngslawtrymalagqpiqwasqlgfqys
    rqqllnsyqivylsntltvpvqfsllgkqasvapfvgadvgalksnhpdartirmaglaa
    gvrfdlpyarmsftyskppvwlyinaglsf