PDB entry 3njs

View 3njs on RCSB PDB site
Description: Crystal structure of the complex formed between typeI ribosome inactivating protein and lactose at 2.1A resolution
Class: Hydrolase
Keywords: RIP, RNA N-glycosidase, Plant protein, Lactose, Hydrolase
Deposited on 2010-06-18, released 2010-07-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NJS (0-245)
    Domains in SCOPe 2.04: d3njsa_
  • Heterogens: LAT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3njsA (A:)
    dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
    tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
    prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
    lntkni