PDB entry 3njq

View 3njq on RCSB PDB site
Description: crystal structure of kaposi's sarcoma-associated herpesvirus protease in complex with dimer disruptor
Deposited on 2010-06-17, released 2011-08-17
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf 17
    Species: Human herpesvirus 8 type M [TaxId:435895]
    Gene: Rhadinovirus
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: orf 17
    Species: Human herpesvirus 8 type M [TaxId:435895]
    Gene: Rhadinovirus
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, NJQ, SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njqA (A:)
    glyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvsh
    gifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihprel
    sqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrled
    lstpnfvspletl
    

    Sequence, based on observed residues (ATOM records):
    >3njqA (A:)
    glyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvsh
    gifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihprel
    sqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrled
    lstpnfvspl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3njqB (B:)
    glyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvsh
    gifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihprel
    sqtpsgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrled
    lstpnfvspletl
    

    Sequence, based on observed residues (ATOM records):
    >3njqB (B:)
    glyvggfvdvvscpkleqelyldpdqvtdylpvteplpitiehlpetevgwtlglfqvsh
    gifctgaitspaflelasrladtshvarapvknlpkeplleilhtwlpglslssihprep
    sgpvfqhvslcalgrrrgtvavyghdaewvvsrfssvskserahilqhvsscrledlstp
    nfvspletl