PDB entry 3njp

View 3njp on RCSB PDB site
Description: the extracellular and transmembrane domain interfaces in epidermal growth factor receptor signaling
Deposited on 2010-06-17, released 2010-10-13
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (0-613)
      • conflict (515)
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (0-613)
      • conflict (515)
  • Chain 'C':
    Compound: epidermal growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGF
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: epidermal growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGF
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, 2PE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3njpA (A:)
    leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe
    vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil
    hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgage
    encqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtc
    pplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvr
    kckkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsftht
    ppldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvsln
    itslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
    vchalcspegcwgpeprdcvscrnvsrgrecvdkckllegeprefvenseciqchpeclp
    qamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlchpnc
    tygctgpglegcpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3njpB (B:)
    leekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqe
    vagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeil
    hgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgage
    encqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtc
    pplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvr
    kckkcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsftht
    ppldpqeldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvsln
    itslglrslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
    vchalcspegcwgpeprdcvscrnvsrgrecvdkckllegeprefvenseciqchpeclp
    qamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlchpnc
    tygctgpglegcpt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3njpC (C:)
    ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3njpD (D:)
    ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe