PDB entry 3njo

View 3njo on RCSB PDB site
Description: x-ray crystal structure of the pyr1-pyrabactin a complex
Deposited on 2010-06-17, released 2010-08-18
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abscisic acid receptor PYR1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ABIP6, At4g17870, PYR1, RCAR11, T6K21.50
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49686
      • engineered (90)
  • Chain 'B':
    Compound: Abscisic acid receptor PYR1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ABIP6, At4g17870, PYR1, RCAR11, T6K21.50
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49686
      • engineered (90)
  • Chain 'C':
    Compound: Abscisic acid receptor PYR1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ABIP6, At4g17870, PYR1, RCAR11, T6K21.50
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49686
      • engineered (90)
  • Heterogens: PYV, SO4, NA, P2M, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njoA (A:)
    gshmpseltpeerselknsiaefhtyqldpgscsslhaqrihappelvwsivrrfdkpqt
    ykhfikscsveqnfemrvgctrdvivisglsantsterldildderrvtgfsiiggehrl
    tnyksvttvhrfekenriwtvvlesyvvdmpegnseddtrmfadtvvklnlqklatvaea
    marnsgdgsgsqvt
    

    Sequence, based on observed residues (ATOM records):
    >3njoA (A:)
    tpeerselknsiaefhtyqldpgscsslhaqrihappelvwsivrrfdkpqtykhfiksc
    sveqnfemrvgctrdvivisglsantsterldildderrvtgfsiiggehrltnyksvtt
    vhrfekenriwtvvlesyvvdmpdtrmfadtvvklnlqklatvaeamar
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3njoB (B:)
    gshmpseltpeerselknsiaefhtyqldpgscsslhaqrihappelvwsivrrfdkpqt
    ykhfikscsveqnfemrvgctrdvivisglsantsterldildderrvtgfsiiggehrl
    tnyksvttvhrfekenriwtvvlesyvvdmpegnseddtrmfadtvvklnlqklatvaea
    marnsgdgsgsqvt
    

    Sequence, based on observed residues (ATOM records):
    >3njoB (B:)
    eltpeerselknsiaefhtyqldpgscsslhaqrihappelvwsivrrfdkpqtykhfik
    scsveqnfemrvgctrdvivisglsantsterldildderrvtgfsiiggehrltnyksv
    ttvhrfekenriwtvvlesyvvdmpegnseddtrmfadtvvklnlqklatvaeamar
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3njoC (C:)
    gshmpseltpeerselknsiaefhtyqldpgscsslhaqrihappelvwsivrrfdkpqt
    ykhfikscsveqnfemrvgctrdvivisglsantsterldildderrvtgfsiiggehrl
    tnyksvttvhrfekenriwtvvlesyvvdmpegnseddtrmfadtvvklnlqklatvaea
    marnsgdgsgsqvt
    

    Sequence, based on observed residues (ATOM records):
    >3njoC (C:)
    seltpeerselknsiaefhtyqldpgscsslhaqrihappelvwsivrrfdkpqtykhfi
    kscsveqnfemrvgctrdvivisglsantsterldildderrvtgfsiiggehrltnyks
    vttvhrfekenriwtvvlesyvvdmdtrmfadtvvklnlqklatvaeamar