PDB entry 3njk

View 3njk on RCSB PDB site
Description: d116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph5.5
Deposited on 2010-06-17, released 2010-07-21
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidase
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO_1698
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EGA7
      • engineered mutation (118)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njkA (A:)
    snamfapqglaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkg
    lkfvgvgfvtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspap
    qiinrpqn
    

    Sequence, based on observed residues (ATOM records):
    >3njkA (A:)
    apqglaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkglkfvg
    vgfvtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspapqiinr
    pq