PDB entry 3njf

View 3njf on RCSB PDB site
Description: y26f mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis
Deposited on 2010-06-17, released 2010-07-07
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidase
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO_1698
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EGA7 (Start-118)
      • engineered mutation (28)
  • Chain 'B':
    Compound: Peptidase
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO_1698
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Peptidase
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO_1698
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EGA7 (Start-118)
      • engineered mutation (28)
  • Chain 'D':
    Compound: Peptidase
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO_1698
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njfA (A:)
    snamfapqglaqfikvnvtlengepvfiftdangqvcqgditvtqagtityllndqtlkg
    lkfvgvgfvtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspd
    

    Sequence, based on observed residues (ATOM records):
    >3njfA (A:)
    qglaqfikvnvtlengepvfiftdangqvcqgditvtqagtityllndqtlkglkfvgvg
    fvtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3njfB (B:)
    pqiinrpqn
    

    Sequence, based on observed residues (ATOM records):
    >3njfB (B:)
    pqiinrp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3njfC (C:)
    snamfapqglaqfikvnvtlengepvfiftdangqvcqgditvtqagtityllndqtlkg
    lkfvgvgfvtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspd
    

    Sequence, based on observed residues (ATOM records):
    >3njfC (C:)
    qglaqfikvnvtlengepvfiftdangqvcqgditvtqagtityllndqtlkglkfvgvg
    fvtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3njfD (D:)
    pqiinrpqn
    

    Sequence, based on observed residues (ATOM records):
    >3njfD (D:)
    pqiinrp