PDB entry 3nje

View 3nje on RCSB PDB site
Description: Structure of the Minor Pseudopilin XcpW from the Pseudomonas aeruginosa Type II Secretion System
Class: protein transport
Keywords: Type II secretion, Pseudopilin, minor pilin, pilin fold, secretion, XcpU, XcpV, XcpX, PROTEIN TRANSPORT
Deposited on 2010-06-17, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General secretion pathway protein J
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: xcpW, pddD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3njea_
  • Chain 'B':
    Compound: General secretion pathway protein J
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: xcpW, pddD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3njeb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3njeA (A:)
    grmfdsvmqtdqatrvqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegen
    dqiveftrggwrnplgqarsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvt
    alswrfldkehnwqghwptdegseeerleslplavemtlehrhygklvrvwrlldpplkq
    dqpqgqpggengengeggvpqppegmpgape
    

    Sequence, based on observed residues (ATOM records): (download)
    >3njeA (A:)
    rvqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwlqr
    vrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghwptdegse
    eerleslplavemtlehrhygklvrvwrlldpplkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3njeB (B:)
    grmfdsvmqtdqatrvqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegen
    dqiveftrggwrnplgqarsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvt
    alswrfldkehnwqghwptdegseeerleslplavemtlehrhygklvrvwrlldpplkq
    dqpqgqpggengengeggvpqppegmpgape
    

    Sequence, based on observed residues (ATOM records): (download)
    >3njeB (B:)
    qeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwrnplg
    qarsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqgh
    wptdegseeerleslplavemtlehrhygklvrvwrlldpplkq