PDB entry 3njd

View 3njd on RCSB PDB site
Description: crystal structure of enoyl-coa hydratase from mycobacterium smegmatis
Deposited on 2010-06-17, released 2010-07-28
The last revision was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1388
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1388
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njdA (A:)
    mahhhhhhmgtleaqtqgpgsmthairpvdfdnlktmtyevtdrvaritfnrpekgnaiv
    adtplelsalveradldpdvhvilvsgrgegfcagfdlsayaegsssagggspyegtvls
    gktqalnhlpdepwdpmvdyqmmsrfvrgfaslmhcdkptvvkihgycvaggtdialhad
    qviaaadakigyppmrvwgvpaaglwahrlgdqrakrllftgdcitgaqaaewglaveap
    dpadldarterlveriaampvnqlimaklacntallnqgvatsqmvstvfdgiarhtpeg
    hafvatarehgfreavrrrdepmgdhgrrasdv
    

    Sequence, based on observed residues (ATOM records):
    >3njdA (A:)
    vdfdnlktmtyevtdrvaritfnrpekgnaivadtplelsalveradldpdvhvilvsgr
    gegfcagfdpyegtvlsgktqalnhlpdepwdpmvdyqmmsrfvrgfaslmhcdkptvvk
    ihgycvaggtdialhadqviaaadakigyppmrvwgvpaaglwahrlgdqrakrllftgd
    citgaqaaewglaveapdpadldarterlveriaampvnqlimaklacntallnqgvats
    qmvstvfdgiarhtpeghafvatarehgfreavrrrdepmgdhgrrasdv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3njdB (B:)
    mahhhhhhmgtleaqtqgpgsmthairpvdfdnlktmtyevtdrvaritfnrpekgnaiv
    adtplelsalveradldpdvhvilvsgrgegfcagfdlsayaegsssagggspyegtvls
    gktqalnhlpdepwdpmvdyqmmsrfvrgfaslmhcdkptvvkihgycvaggtdialhad
    qviaaadakigyppmrvwgvpaaglwahrlgdqrakrllftgdcitgaqaaewglaveap
    dpadldarterlveriaampvnqlimaklacntallnqgvatsqmvstvfdgiarhtpeg
    hafvatarehgfreavrrrdepmgdhgrrasdv
    

    Sequence, based on observed residues (ATOM records):
    >3njdB (B:)
    pvdfdnlktmtyevtdrvaritfnrpekgnaivadtplelsalveradldpdvhvilvsg
    rgegfcagfdlpyegtvlsgktqalnhlpdepwdpmvdyqmmsrfvrgfaslmhcdkptv
    vkihgycvaggtdialhadqviaaadakigyppmrvwgvpaaglwahrlgdqrakrllft
    gdcitgaqaaewglaveapdpadldarterlveriaampvnqlimaklacntallnqgva
    tsqmvstvfdgiarhtpeghafvatarehgfreavrrrdepmgdhgrrasdv