PDB entry 3njc

View 3njc on RCSB PDB site
Description: crystal structure of the yslb protein from bacillus subtilis. northeast structural genomics consortium target sr460.
Deposited on 2010-06-17, released 2010-09-22
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YSLB protein
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU28460, yslB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42955 (10-End)
      • expression tag (2-9)
  • Chain 'B':
    Compound: YSLB protein
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU28460, yslB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42955 (10-End)
      • expression tag (7-9)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njcA (A:)
    mghhhhhhshmkskfeasidnlkeiemnayayelireivlpdmlgqdyssmmywagkhla
    rkfplesweefpaffeeagwgtltnvsakkqelefelegpiisnrlkhqkepcfqleagf
    iaeqiqlmndqiaesyeqvkkradkvvltvkwdmkdpv
    

    Sequence, based on observed residues (ATOM records):
    >3njcA (A:)
    hhhhhhshmkskfeasidnlkeiemnayayelireivlpdmlgqdyssmmywagkhlark
    fplesweefpaffeeagwgtltnvsakkqelefelegpiisnrlkhqkepcfqleagfia
    eqiqlmndqiaesyeqvkkradkvvltvkwdmk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3njcB (B:)
    mghhhhhhshmkskfeasidnlkeiemnayayelireivlpdmlgqdyssmmywagkhla
    rkfplesweefpaffeeagwgtltnvsakkqelefelegpiisnrlkhqkepcfqleagf
    iaeqiqlmndqiaesyeqvkkradkvvltvkwdmkdpv
    

    Sequence, based on observed residues (ATOM records):
    >3njcB (B:)
    hshmkskfeasidnlkeiemnayayelireivlpdmlgqdyssmmywagkhlarkfples
    weefpaffeeagwgtltnvsakkqelefelegpiisnrlkhqkepcfqleagfiaeqiql
    mndqiaesyeqvkkradkvvltvkwd