PDB entry 3nja

View 3nja on RCSB PDB site
Description: The crystal structure of the PAS domain of a GGDEF family protein from Chromobacterium violaceum ATCC 12472.
Deposited on 2010-06-17, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.212
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GGDEF family protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV_1582
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Probable GGDEF family protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV_1582
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Probable GGDEF family protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV_1582
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Probable GGDEF family protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV_1582
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, SO4, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3njaA (A:)
    snamaekllhtaesdagigswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhp
    ddrarvrreldrhvlgdrpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidm
    tehkq
    

    Sequence, based on observed residues (ATOM records):
    >3njaA (A:)
    gigswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhpddrarvrreldrhvlg
    drpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidmte
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3njaB (B:)
    snamaekllhtaesdagigswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhp
    ddrarvrreldrhvlgdrpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidm
    tehkq
    

    Sequence, based on observed residues (ATOM records):
    >3njaB (B:)
    dagigswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhpddrarvrreldrhv
    lgdrpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidmte
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3njaC (C:)
    snamaekllhtaesdagigswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhp
    ddrarvrreldrhvlgdrpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidm
    tehkq
    

    Sequence, based on observed residues (ATOM records):
    >3njaC (C:)
    agigswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhpddrarvrreldrhvl
    gdrpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidmteh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3njaD (D:)
    snamaekllhtaesdagigswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhp
    ddrarvrreldrhvlgdrpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidm
    tehkq
    

    Sequence, based on observed residues (ATOM records):
    >3njaD (D:)
    igswvlhmesgrlewsqavhdifgtdsatfdatedayfqrvhpddrarvrreldrhvlgd
    rpfdveyrivrpdgqvrellernhiqrqasgqvdhlwgtvidmte