PDB entry 3nj8

View 3nj8 on RCSB PDB site
Description: Crystal structure of T. gondii enoyl acyl carrier protein reductase with bound triclosan like inhibitor
Class: Oxidoreductase
Keywords: enoyl reductase, ENR triclosan, Rossmann NAD binding fold, NADH binding, Oxidoreductase
Deposited on 2010-06-17, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.276
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nj8a_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nj8b_
  • Heterogens: NAD, NJ8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nj8A (A:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nj8A (A:)
    fpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrlded
    rklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnid
    ilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaa
    ervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigeksfid
    yaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmp
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nj8B (B:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nj8B (B:)
    pidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrldedr
    klpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnidi
    lvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaae
    rvvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaiksfidyai
    dysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmpp