PDB entry 3nj4

View 3nj4 on RCSB PDB site
Description: Fluoro-neplanocin A in Human S-Adenosylhomocysteine Hydrolase
Deposited on 2010-06-17, released 2011-05-04
The last revision was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylhomocysteinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCY, SAHH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Adenosylhomocysteinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCY, SAHH
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Adenosylhomocysteinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCY, SAHH
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Adenosylhomocysteinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCY, SAHH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, AFX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nj4A (A:)
    gshmsdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmt
    vetavlietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqt
    lyfkdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpa
    invndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfga
    rviiteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivc
    nighfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfv
    msnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqyl
    gmscdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records):
    >3nj4A (A:)
    sdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtveta
    vlietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyfk
    dgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmsc
    dgpfkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nj4B (B:)
    gshmsdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmt
    vetavlietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqt
    lyfkdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpa
    invndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfga
    rviiteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivc
    nighfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfv
    msnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqyl
    gmscdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records):
    >3nj4B (B:)
    dklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetav
    lietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyfkd
    gplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmscd
    gpfkpdhyry
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nj4C (C:)
    gshmsdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmt
    vetavlietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqt
    lyfkdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpa
    invndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfga
    rviiteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivc
    nighfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfv
    msnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqyl
    gmscdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records):
    >3nj4C (C:)
    sdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtveta
    vlietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyfk
    dgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmsc
    dgpfkpdhyry
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nj4D (D:)
    gshmsdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmt
    vetavlietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqt
    lyfkdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpa
    invndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfga
    rviiteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivc
    nighfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfv
    msnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqyl
    gmscdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records):
    >3nj4D (D:)
    dklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetav
    lietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyfkd
    gplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmscd
    gpfkpdhyry