PDB entry 3nj2

View 3nj2 on RCSB PDB site
Description: Crystal structure of cce_0566 from the cyanobacterium Cyanothece 51142, a protein associated with nitrogen fixation from the DUF269 family
Deposited on 2010-06-16, released 2010-07-07
The last revision was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.212
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DUF269-containing protein
    Species: Cyanothece sp. ATCC 51142 [TaxId:43989]
    Gene: cce_0566
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DUF269-containing protein
    Species: Cyanothece sp. ATCC 51142 [TaxId:43989]
    Gene: cce_0566
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nj2A (A:)
    mgsshhhhhhssglvprgshmtnsetntllveqspflqslvqqiraydhygvyrtwtdel
    viapyvipkkkrreislegdidpttklrilcyfraiaalieketgllcqvvvdlnhegfg
    walvwggklmvvsrslrdahrfgfdtleklndqgtklanagielvnkfpevarl
    

    Sequence, based on observed residues (ATOM records):
    >3nj2A (A:)
    setntllveqspflqslvqqiraydhygvyrtwtdelviapyvipkkkrreislegdidp
    ttklrilcyfraiaalieketgllcqvvvdlnhegfgwalvwggklmvvsrslrdahrfg
    fdtleklndqgtklanagielvnkfpevarl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nj2B (B:)
    mgsshhhhhhssglvprgshmtnsetntllveqspflqslvqqiraydhygvyrtwtdel
    viapyvipkkkrreislegdidpttklrilcyfraiaalieketgllcqvvvdlnhegfg
    walvwggklmvvsrslrdahrfgfdtleklndqgtklanagielvnkfpevarl
    

    Sequence, based on observed residues (ATOM records):
    >3nj2B (B:)
    nsetntllveqspflqslvqqiraydhygvyrtwtdelviapyvipkkkrreislegdid
    pttklrilcyfraiaalieketgllcqvvvdlnhegfgwalvwggklmvvsrslrdahrf
    gfdtleklndqgtklanagielvnkfpevarl