PDB entry 3niz

View 3niz on RCSB PDB site
Description: Cryptosporidium parvum cyclin-dependent kinase cgd5_2510 with ADP bound.
Class: transferase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, phosphotransferase, cyclin dependent kinase, TRANSFERASE
Deposited on 2010-06-16, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhodanese family protein
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd5_2510
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CRJ8 (18-310)
      • expression tag (14-17)
    Domains in SCOPe 2.07: d3niza1, d3niza2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nizA (A:)
    mhhhhhhssgrenlyfqglmekyqklekvgegtygvvykakdsqgrivalkrirldaede
    gipstaireisllkelhhpnivslidvihsercltlvfefmekdlkkvldenktglqdsq
    ikiylyqllrgvahchqhrilhrdlkpqnllinsdgalkladfglarafgipvrsythev
    vtlwyrapdvlmgskkystsvdiwsigcifaemitgkplfpgvtdddqlpkifsilgtpn
    prewpqvqelplwkqrtfqvfekkpwssiipgfcqegidllsnmlcfdpnkrisardamn
    hpyfkdldpqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nizA (A:)
    yfqglmekyqklekvgegtygvvykakdsqgrivalkrirgipstaireisllkelhhpn
    ivslidvihsercltlvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqhri
    lhrdlkpqnllinsdgalkladfglarafgipvrhevvtlwyrapdvlmgskkystsvdi
    wsigcifaemitgkplfpgvtdddqlpkifsilgtpnprewpqvqelplwkqrtfqvfek
    kpwssiipgfcqegidllsnmlcfdpnkrisardamnhpyfkdldpqi