PDB entry 3niw

View 3niw on RCSB PDB site
Description: Crystal structure of a haloacid dehalogenase-like hydrolase from Bacteroides thetaiotaomicron
Class: Structural Genomics, Unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2010-06-16, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_3352
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3niwa_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3niwA (A:)
    mslkyklivldldgtltnskkeissrnretliriqeqgirlvlasgrptygivplanelr
    mnefggfilsynggeiinweskemmyenvlpnevvpvlyecartnhlsiltydgaeivte
    nsldpyvqkeaflnkmairetndfltditlpvakclivgdagklipveselcirlqgkin
    vfrsepyflelvpqgidkalslsvllenigmtreeviaigdgyndlsmikfagmgvamgn
    aqepvkkaadyitltndedgvaeaierifnveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3niwA (A:)
    kyklivldldgtltnskkeissrnretliriqeqgirlvlasgrptygivplanelrmne
    fggfilsynggeiinweskemmyenvlpnevvpvlyecartnhlsiltydgaeivtensl
    dpyvqkeaflnkmairetndfltditlpvakclivgdagklipveselcirlqgkinvfr
    sepyflelvpqgidkalslsvllenigmtreeviaigdgyndlsmikfagmgvamgnaqe
    pvkkaadyitltndedgvaeaierif