PDB entry 3niu

View 3niu on RCSB PDB site
Description: Crystal structure of the complex of dimeric goat lactoperoxidase with diethylene glycol at 2.9 A resolution
Deposited on 2010-06-16, released 2010-07-14
The last revision was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.201
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactoperoxidase
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Lactoperoxidase
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, PO4, CA, HEM, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3niuA (A:)
    swevgcgapvplvtcdeqspyrtitgdcnnrrspalgaanralarwlpaeyedglavpfg
    wtqrktrngfrvplarevsnkivgyldeegvldqnrsllfmqwgqivdhdldfapetelg
    ssehskvqceeycvqgdecfpimfpkndpklktqgkcmpffragfvcptppyqslardqi
    navtsfldaslvygsepslasrlrnlssplglmavnqeawdhglayppfnnvkpspcefi
    nttahvpcfqagdsraseqillatvhtlllrehnrlarelkrlnphwdgemlyqearkil
    gafiqiitfrdylpivlgsemqkwippyqgynnsvdprisnvftfafrfghmevpstvsr
    ldenyqpwgpeaelplhtlffntwriikdggidplvrgllaknsklmnqnkmvtselrnk
    lfqpthkvhgfdlaainlqrcrdhgmpgynswrgfcglsqpktlkglqavlknkvlakkl
    ldlyktpdnidiwiggnaepmvergrvgpllacllgrqfqqirdgdrfwwenpgvftekq
    rdslqkvsfsrlicdnthitkvplhafqannyphdfvdcsavdkldlspwasren
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3niuB (B:)
    swevgcgapvplvtcdeqspyrtitgdcnnrrspalgaanralarwlpaeyedglavpfg
    wtqrktrngfrvplarevsnkivgyldeegvldqnrsllfmqwgqivdhdldfapetelg
    ssehskvqceeycvqgdecfpimfpkndpklktqgkcmpffragfvcptppyqslardqi
    navtsfldaslvygsepslasrlrnlssplglmavnqeawdhglayppfnnvkpspcefi
    nttahvpcfqagdsraseqillatvhtlllrehnrlarelkrlnphwdgemlyqearkil
    gafiqiitfrdylpivlgsemqkwippyqgynnsvdprisnvftfafrfghmevpstvsr
    ldenyqpwgpeaelplhtlffntwriikdggidplvrgllaknsklmnqnkmvtselrnk
    lfqpthkvhgfdlaainlqrcrdhgmpgynswrgfcglsqpktlkglqavlknkvlakkl
    ldlyktpdnidiwiggnaepmvergrvgpllacllgrqfqqirdgdrfwwenpgvftekq
    rdslqkvsfsrlicdnthitkvplhafqannyphdfvdcsavdkldlspwasren