PDB entry 3nip

View 3nip on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane
Class: hydrolase
Keywords: guanidinopropionase, GpuA, PA0288, HYDROLASE
Deposited on 2010-06-16, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-guanidinopropionase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gpuA, PA0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nipa_
  • Chain 'B':
    Compound: 3-guanidinopropionase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gpuA, PA0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nipb_
  • Chain 'C':
    Compound: 3-guanidinopropionase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gpuA, PA0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nipc_
  • Chain 'D':
    Compound: 3-guanidinopropionase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gpuA, PA0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nipd_
  • Chain 'E':
    Compound: 3-guanidinopropionase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gpuA, PA0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nipe_
  • Chain 'F':
    Compound: 3-guanidinopropionase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gpuA, PA0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nipf_
  • Heterogens: 16D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nipA (A:)
    msndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgpre
    vrnlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlpl
    svggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldp
    lrtvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfd
    vdvldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvga
    tmmfellcllaesaarsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nipA (A:)
    ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
    nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
    ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
    tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
    vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
    mfellcllaesaarsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nipB (B:)
    msndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgpre
    vrnlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlpl
    svggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldp
    lrtvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfd
    vdvldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvga
    tmmfellcllaesaarsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nipB (B:)
    ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
    nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
    ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
    tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
    vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
    mfellcllaesaarsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nipC (C:)
    msndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgpre
    vrnlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlpl
    svggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldp
    lrtvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfd
    vdvldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvga
    tmmfellcllaesaarsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nipC (C:)
    ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
    nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
    ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
    tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
    vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
    mfellcllaesaarsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nipD (D:)
    msndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgpre
    vrnlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlpl
    svggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldp
    lrtvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfd
    vdvldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvga
    tmmfellcllaesaarsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nipD (D:)
    ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
    nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
    ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
    tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
    vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
    mfellcllaesaarsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nipE (E:)
    msndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgpre
    vrnlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlpl
    svggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldp
    lrtvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfd
    vdvldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvga
    tmmfellcllaesaarsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nipE (E:)
    ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
    nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
    ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
    tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
    vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
    mfellcllaesaarsa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nipF (F:)
    msndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgpre
    vrnlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlpl
    svggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldp
    lrtvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfd
    vdvldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvga
    tmmfellcllaesaarsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nipF (F:)
    ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
    nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
    ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
    tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
    vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
    mfellcllaesaarsa