PDB entry 3nio

View 3nio on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa guanidinobutyrase
Class: hydrolase
Keywords: PA1421, guanidinobutyrase, GbuA, HYDROLASE
Deposited on 2010-06-16, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanidinobutyrase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gbuA, PA1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nioa_
  • Chain 'B':
    Compound: Guanidinobutyrase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gbuA, PA1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3niob_
  • Chain 'C':
    Compound: Guanidinobutyrase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gbuA, PA1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nioc_
  • Chain 'D':
    Compound: Guanidinobutyrase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gbuA, PA1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3niod_
  • Chain 'E':
    Compound: Guanidinobutyrase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gbuA, PA1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nioe_
  • Chain 'F':
    Compound: Guanidinobutyrase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gbuA, PA1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3niof_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nioA (A:)
    mdknlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfg
    preiraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgi
    lpltlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedl
    ldcdrvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvyl
    sfdidgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsl
    lganllyemlcvlpgvvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nioA (A:)
    nlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfgpre
    iraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgilpl
    tlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedlldc
    drvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvylsfd
    idgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsllga
    nllyemlcvlpgvvrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nioB (B:)
    mdknlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfg
    preiraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgi
    lpltlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedl
    ldcdrvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvyl
    sfdidgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsl
    lganllyemlcvlpgvvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nioB (B:)
    nlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfgpre
    iraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgilpl
    tlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedlldc
    drvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvylsfd
    idgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsllga
    nllyemlcvlpgvvrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nioC (C:)
    mdknlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfg
    preiraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgi
    lpltlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedl
    ldcdrvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvyl
    sfdidgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsl
    lganllyemlcvlpgvvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nioC (C:)
    nlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfgpre
    iraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgilpl
    tlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedlldc
    drvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvylsfd
    idgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsllga
    nllyemlcvlpgvvrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nioD (D:)
    mdknlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfg
    preiraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgi
    lpltlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedl
    ldcdrvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvyl
    sfdidgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsl
    lganllyemlcvlpgvvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nioD (D:)
    nlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfgpre
    iraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgilpl
    tlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedlldc
    drvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvylsfd
    idgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsllga
    nllyemlcvlpgvvrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nioE (E:)
    mdknlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfg
    preiraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgi
    lpltlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedl
    ldcdrvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvyl
    sfdidgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsl
    lganllyemlcvlpgvvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nioE (E:)
    nlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfgpre
    iraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgilpl
    tlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedlldc
    drvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvylsfd
    idgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsllga
    nllyemlcvlpgvvrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nioF (F:)
    mdknlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfg
    preiraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgi
    lpltlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedl
    ldcdrvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvyl
    sfdidgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsl
    lganllyemlcvlpgvvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nioF (F:)
    nlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfgpre
    iraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgilpl
    tlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedlldc
    drvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvylsfd
    idgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsllga
    nllyemlcvlpgvvrr