PDB entry 3nik

View 3nik on RCSB PDB site
Description: the structure of ubr box (reaa)
Deposited on 2010-06-16, released 2010-09-15
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UBR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19812 (2-81)
      • expression tag (0-1)
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UBR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19812 (2-81)
      • expression tag (0-1)
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase UBR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19812 (2-81)
      • expression tag (0-1)
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase UBR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Peptide REAA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NIK (0-3)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nikA (A:)
    gsvhkhtgrncgrkfkigeplyrchecgcddtcvlcihcfnpkdhvnhhvctdictefts
    gicdcgdeeawnsplhckaeeq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nikB (B:)
    gsvhkhtgrncgrkfkigeplyrchecgcddtcvlcihcfnpkdhvnhhvctdictefts
    gicdcgdeeawnsplhckaeeq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3nikD (D:)
    gsvhkhtgrncgrkfkigeplyrchecgcddtcvlcihcfnpkdhvnhhvctdictefts
    gicdcgdeeawnsplhckaeeq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nikF (F:)
    gsvhkhtgrncgrkfkigeplyrchecgcddtcvlcihcfnpkdhvnhhvctdictefts
    gicdcgdeeawnsplhckaeeq
    

    Sequence, based on observed residues (ATOM records):
    >3nikF (F:)
    vhkhtgrncgrkfkigeplyrchecgcddtcvlcihcfnpkdhvnhhvctdicteftsgi
    cdcgdeeawnsplhckaeeq
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >3nikX (X:)
    reaa