PDB entry 3nij

View 3nij on RCSB PDB site
Description: the structure of ubr box (hiaa)
Deposited on 2010-06-16, released 2010-09-15
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UBR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peptide HIAA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NIJ (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nijA (A:)
    gsvhkhtgrncgrkfkigeplyrchecgcddtcvlcihcfnpkdhvnhhvctdictefts
    gicdcgdeeawnsplhckaeeq
    

    Sequence, based on observed residues (ATOM records):
    >3nijA (A:)
    vhkhtgrncgrkfkigeplyrchecgcddtcvlcihcfnpkdhvnhhvctdicteftsgi
    cdcgdeeawnsplhckaee
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nijB (B:)
    hiaa
    

    Sequence, based on observed residues (ATOM records):
    >3nijB (B:)
    hia