PDB entry 3nie

View 3nie on RCSB PDB site
Description: crystal structure of pf11_0147
Deposited on 2010-06-15, released 2010-08-11
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP2 kinase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: MAP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GR08 (18-End)
      • expression tag (13-17)
  • Chain 'B':
    Compound: MAP2 kinase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: MAP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nieA (A:)
    mhhhhhhssgrenlyfqgaiiknvkvpdnyeikhligrgsygyvylaydknanknvaikk
    vnrmfedlidckrilreitilnrlksdyiirlhdliipedllkfdelyivleiadsdlkk
    lfktpiflteqhvktilynlllgekfihesgiihrdlkpancllnqdcsvkicdfglart
    insdkdihivndleekeeneepgphnknlkkqltshvvtrwyrapelillqenytnsidi
    wstgcifaellnmmkshinnptnrfplfpgsscfplspdhnskkvheksnrdqlniifnv
    igtppeedlkcitkqevikyiklfptrdgidlskkyssiskegidllesmlrfnaqkrit
    idkalshpylkdvrkenlenfstekiilpfddwmvlsetqlryiflkeiqsfhadliipa
    klnihqksf
    

    Sequence, based on observed residues (ATOM records):
    >3nieA (A:)
    lyfqgaiiknvkvpdnyeikhligrgsygyvylaydknanknvaikkvnrmfedlidckr
    ilreitilnrlksdyiirlhdliipedllkfdelyivleiadsdlkklfktpiflteqhv
    ktilynlllgekfihesgiihrdlkpancllnqdcsvkicdfglartintshvvtrwyra
    pelillqenytnsidiwstgcifaellnmmkshinnptnrfplfpgsscfpheksnrdql
    niifnvigtppeedlkcitkqevikyiklfptrdgidlskkyssiskegidllesmlrfn
    aqkritidkalshpylkdvrkenlenfstekiilpfddwmvlsetqlryiflkeiqsfha
    dliipakln
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nieB (B:)
    mhhhhhhssgrenlyfqgaiiknvkvpdnyeikhligrgsygyvylaydknanknvaikk
    vnrmfedlidckrilreitilnrlksdyiirlhdliipedllkfdelyivleiadsdlkk
    lfktpiflteqhvktilynlllgekfihesgiihrdlkpancllnqdcsvkicdfglart
    insdkdihivndleekeeneepgphnknlkkqltshvvtrwyrapelillqenytnsidi
    wstgcifaellnmmkshinnptnrfplfpgsscfplspdhnskkvheksnrdqlniifnv
    igtppeedlkcitkqevikyiklfptrdgidlskkyssiskegidllesmlrfnaqkrit
    idkalshpylkdvrkenlenfstekiilpfddwmvlsetqlryiflkeiqsfhadliipa
    klnihqksf
    

    Sequence, based on observed residues (ATOM records):
    >3nieB (B:)
    aiiknvkvpdnyeikhligrgsygyvylaydknanknvaikkvnrmfedlidckrilrei
    tilnrlksdyiirlhdliipedllkfdelyivleiadsdlkklfktpiflteqhvktily
    nlllgekfihesgiihrdlkpancllnqdcsvkicdfglartitshvvtrwyrapelill
    qenytnsidiwstgcifaellnmmkshinnptnrfplfpgsscfpheksnrdqlniifnv
    igtppeedlktkqevikyiklfptrdgidlskkyssiskegidllesmlrfnaqkritid
    kalshpylkdvrkenlenfstekiilpfddwmvlsetqlryiflkeiqsfhadliipakl
    nihqksf