PDB entry 3nia

View 3nia on RCSB PDB site
Description: GES-2 carbapenemase tazobactam complex
Class: Hydrolase/Hydrolase Inhibitor
Keywords: beta-lactamase, antibiotic resistance, carbapenemase, lactamase inhibitor, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-06-15, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.157
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase GES-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bla GES-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3niaa_
  • Heterogens: TBE, TF7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3niaA (A:)
    sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
    dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
    gpaamtqyfrkigdsvsrldrkepemndntpgdlrdtttpiamartvakvlyggaltsts
    thtierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytt
    apklsaverdelvasvgqvitqlilstdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3niaA (A:)
    sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
    dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
    gpaamtqyfrkigdsvsrldrkepemndntpgdlrdtttpiamartvakvlyggaltsts
    thtierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytt
    apklsaverdelvasvgqvitqlilst