PDB entry 3ni9

View 3ni9 on RCSB PDB site
Description: GES-2 carbapenemase apo form
Class: hydrolase
Keywords: beta-lactamase, antibiotic resistance, carbapenemase, Hydrolase
Deposited on 2010-06-15, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase GES-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bla GES-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ni9a_
  • Chain 'B':
    Compound: Beta-lactamase GES-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bla GES-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ni9b_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ni9A (A:)
    sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
    dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
    gpaamtqyfrkigdsvsrldrkepemndntpgdlrdtttpiamartvakvlyggaltsts
    thtierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytt
    apklsaverdelvasvgqvitqlilstdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ni9A (A:)
    sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
    dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
    gpaamtqyfrkigdsvsrldrkepemndntpgdlrdtttpiamartvakvlyggaltsts
    thtierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytt
    apklsaverdelvasvgqvitqlilstd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ni9B (B:)
    sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
    dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
    gpaamtqyfrkigdsvsrldrkepemndntpgdlrdtttpiamartvakvlyggaltsts
    thtierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytt
    apklsaverdelvasvgqvitqlilstdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ni9B (B:)
    sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
    dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
    gpaamtqyfrkigdsvsrldrkepemndntpgdlrdtttpiamartvakvlyggaltsts
    thtierwlignqtgdatlragfpkdwvvgektgtcanggrndigffkaqerdyavavytt
    apklsaverdelvasvgqvitqlilstd