PDB entry 3ni7

View 3ni7 on RCSB PDB site
Description: Crystal structure of the TetR transcriptional regulator from Nitrosomonas europaea ATCC 19718
Deposited on 2010-06-15, released 2010-08-11
The last revision was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial regulatory proteins, TetR family
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0300
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bacterial regulatory proteins, TetR family
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0300
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ni7A (A:)
    mtinndpmrdaivdtavelaahtsweavrlydiaarlavsldeirlyfrekdelidawfd
    radsrmlkeaesagfldlvaserihhlimiwldalavqrkvtrqmimsklefghihiqip
    avmrvsrtvqwvreaaqrdatfmrraleestlttiylmtfffwmrdesensrhtrqflkr
    hltmaawlgqkvygkdpekstvphkqqiplqfd
    

    Sequence, based on observed residues (ATOM records):
    >3ni7A (A:)
    dpmrdaivdtavelaahtsweavrlydiaarlavsldeirlyfrekdelidawfdradsr
    mlkeaesagfldlvaserihhlimiwldalavqrkvtrqmimsklehihiqipavmrvsr
    tvqwvreaaqraleestlttiylmtfffwmrdesensrhtrqflkrhltmaawl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ni7B (B:)
    mtinndpmrdaivdtavelaahtsweavrlydiaarlavsldeirlyfrekdelidawfd
    radsrmlkeaesagfldlvaserihhlimiwldalavqrkvtrqmimsklefghihiqip
    avmrvsrtvqwvreaaqrdatfmrraleestlttiylmtfffwmrdesensrhtrqflkr
    hltmaawlgqkvygkdpekstvphkqqiplqfd
    

    Sequence, based on observed residues (ATOM records):
    >3ni7B (B:)
    dpmrdaivdtavelaahtsweavrlydiaarlavsldeirlyfrekdelidawfdradsr
    mlkeaesagfldlvaserihhlimiwldalavqrkvtrqmimsklehihiqipavmrvsr
    tvqwvreaaqrleestlttiylmtfffwmrdesensrhtrqflkrhltmaawl