PDB entry 3ni6

View 3ni6 on RCSB PDB site
Description: Crystal structure of the FK506 binding domain of Plasmodium vivax FKBP35
Class: isomerase
Keywords: FK506 binding domain, ISOMERASE
Deposited on 2010-06-15, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.173
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 70 kDa peptidylprolyl isomerase
    Species: Plasmodium vivax [TaxId:5855]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ni6a_
  • Chain 'B':
    Compound: 70 kDa peptidylprolyl isomerase
    Species: Plasmodium vivax [TaxId:5855]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ni6b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ni6A (A:)
    meqetleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrer
    nvpfkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeie
    lisfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ni6A (A:)
    qetleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernv
    pfkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeieli
    sfre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ni6B (B:)
    meqetleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrer
    nvpfkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeie
    lisfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ni6B (B:)
    leqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvpfk
    fhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielisfr
    e