PDB entry 3ni2

View 3ni2 on RCSB PDB site
Description: Crystal structures and enzymatic mechanisms of a Populus tomentosa 4-coumarate:CoA ligase
Class: Ligase
Keywords: 4-coumarate:CoA ligase, 4CL, phenylpropanoid biosynthesis, Ligase
Deposited on 2010-06-14, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-coumarate:CoA ligase
    Species: Populus tomentosa [TaxId:118781]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ni2a_
  • Heterogens: AYL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ni2A (A:)
    mnpqeefifrsklpdiyipknlplhsyvlenlsnhsskpclingangdvytyadveltar
    rvasglnkigiqqgdvimlflpsspefvlaflgashrgaiitaanpfstpaelakhakas
    rakllitqacyyekvkdfaresdvkvmcvdsapdgclhfseltqadeneapqvdispddv
    valpyssgttglpkgvmlthkglitsvaqqvdgdnpnlyfhsedvilcvlpmfhiyalns
    imlcglrvgapilimpkfeigsllgliekykvsiapvvppvmmsiakspdldkhdlsslr
    miksggaplgkeledtvrakfpqarlgqgygmteagpvlamclafakepfdikpgacgtv
    vrnaemkivdpetgaslprnqpgeicirgdqimkgylndpeatsrtidkegwlhtgdigy
    iddddelfivdrlkelikykgfqvapaelealliahpeisdaavvglkdedagevpvafv
    vkseksqatedeikqyiskqvifykrikrvffieaipkapsgkilrknlkeklagi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ni2A (A:)
    eefifrsklpdiyipknlplhsyvlenlsnhsskpclingangdvytyadveltarrvas
    glnkigiqqgdvimlflpsspefvlaflgashrgaiitaanpfstpaelakhakasrakl
    litqacyyekvkdfaresdvkvmcvdsapdgclhfseltqadeneapqvdispddvvalp
    yssgttglpkgvmlthkglitsvaqqvdgdnpnlyfhsedvilcvlpmfhiyalnsimlc
    glrvgapilimpkfeigsllgliekykvsiapvvppvmmsiakspdldkhdlsslrmiks
    ggaplgkeledtvrakfpqarlgqgygmteagpvlamclafakepfdikpgacgtvvrna
    emkivdpetgaslprnqpgeicirgdqimkgylndpeatsrtidkegwlhtgdigyiddd
    delfivdrlkelikykgfqvapaelealliahpeisdaavvglkdedagevpvafvvkse
    ksqatedeikqyiskqvifykrikrvffieaipkapsgkilrknlkek