PDB entry 3nhy

View 3nhy on RCSB PDB site
Description: X-ray Crystallographic Structure Activity Relationship (SAR) of Casimiroin and its Analogs Bound to Human Quinone Reductase 2
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: protein dimer, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-06-14, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosyldihydronicotinamide dehydrogenase [quinone]
    Species: Homo sapiens [TaxId:9606]
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhya_
  • Chain 'B':
    Compound: Ribosyldihydronicotinamide dehydrogenase [quinone]
    Species: Homo sapiens [TaxId:9606]
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhyb_
  • Heterogens: ZN, FAD, A7B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nhyA (A:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nhyB (B:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq