PDB entry 3nhx

View 3nhx on RCSB PDB site
Description: Crystal Structure of Ketosteroid Isomerase D99N from Pseudomonas Testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
Class: isomerase
Keywords: isomerase
Deposited on 2010-06-14, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3nhxa_
  • Heterogens: ASD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nhxA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga