PDB entry 3nhv

View 3nhv on RCSB PDB site
Description: Crystal Structure of BH2092 protein from Bacillus halodurans, Northeast Structural Genomics Consortium Target BhR228F
Deposited on 2010-06-14, released 2010-08-11
The last revision was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH2092 protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2092
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: BH2092 protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KB42 (Start-135)
      • expression tag (136-137)
  • Chain 'C':
    Compound: BH2092 protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2092
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: BH2092 protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2092
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: BH2092 protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2092
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nhvA (A:)
    anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnk
    inedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengeveg
    tlgakadlfwnmkkeslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nhvA (A:)
    npneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnki
    nedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengevegt
    lgakadlfwnmkke
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nhvB (B:)
    anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnk
    inedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengeveg
    tlgakadlfwnmkkeslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nhvB (B:)
    npneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnki
    nedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengevegt
    lgakadlfwnmkkesle
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nhvC (C:)
    anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnk
    inedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengeveg
    tlgakadlfwnmkkeslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nhvC (C:)
    anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnk
    inedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengeveg
    tlgakadlfwnmkke
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nhvD (D:)
    anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnk
    inedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengeveg
    tlgakadlfwnmkkeslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nhvD (D:)
    anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnk
    inedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengeveg
    tlgakadlfwnmkk
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nhvE (E:)
    anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnk
    inedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengeveg
    tlgakadlfwnmkkeslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nhvE (E:)
    npneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnki
    nedttkrlskekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengevegt
    lgakadlfwnmkk