PDB entry 3nht

View 3nht on RCSB PDB site
Description: crystal structure of the anst-d7l1-u46619 complex
Deposited on 2010-06-14, released 2010-12-29
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D7 protein
    Species: Anopheles stephensi [TaxId:30069]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: U46, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nhtA (A:)
    qpwkaldaeqalyvykrcyedhlpsgsdrktymtlwnawrlepndaithcyakcvltglq
    iydpqenafksdripvqyqayktitqskqkevteyqkalaaanaksgscvdlynaylpvh
    nrfvnlsrqlyhgtvegaakiyaampeikqkgesfhaycekrawkgnkqsewkngrrykl
    tgspelkdaidcifrglrymddtglkvdeivrdfnlinkselepevrsvlasckgseayd
    yyvclvnsrlkqhfknafdfhelrsadyayllrgkvyenpekvkeemkklnttvhf
    

    Sequence, based on observed residues (ATOM records):
    >3nhtA (A:)
    qpwkaldaeqalyvykrcyedhlpsgsdrktymtlwnawrlepndaithcyakcvltglq
    iydpqenafksdripvqyqayktitqskqkevteyqkalaaanaksgscvdlynaylpvh
    nrfvnlsrqlyhgtvegaakiyaampeikqkgesfhaycekrawkgnkqsewkngrrykl
    tgspelkdaidcifrglrymddtglkvdeivrdfnlinkselepevrsvlasckgseayd
    yyvclvnsrlkqhfknafdfhelrsadyayllrkvyenpekvkeemkklnttvhf