SCOPe 2.08: Structural Classification of Proteins

PDB entry 3nhq

View 3nhq on RCSB PDB site
Description: The dark Pfr structure of the photosensory core module of P. aeruginosa Bacteriophytochrome
Class: signaling protein
Keywords: Photoreceptor, phytochrome, PAS, signaling, SIGNALING PROTEIN
Deposited on 2010-06-14, released 2011-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.08: d3nhqa1, d3nhqa2, d3nhqa3
Chain 'B':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3 (Start-496)
Domains in SCOPe 2.08: d3nhqb1, d3nhqb2, d3nhqb3
Chain 'C':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.08: d3nhqc1, d3nhqc2, d3nhqc3
Chain 'D':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.08: d3nhqd1, d3nhqd2, d3nhqd3
Chain 'E':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.08: d3nhqe1, d3nhqe2, d3nhqe3
Chain 'F':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3 (Start-496)
  - expression tag (497)
Domains in SCOPe 2.08: d3nhqf1, d3nhqf2, d3nhqf3, d3nhqf4
Chain 'G':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3 (Start-496)
Domains in SCOPe 2.08: d3nhqg1, d3nhqg2, d3nhqg3
Chain 'H':
Compound: Bacteriophytochrome
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: bphP, PA4117
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HWR3
Domains in SCOPe 2.08: d3nhqh1, d3nhqh2, d3nhqh3
Heterogens: BLA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3nhqA (A:)
mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
iaeklrldlmelclnhalehhhhhh