PDB entry 3nhq

View 3nhq on RCSB PDB site
Description: The dark Pfr structure of the photosensory core module of P. aeruginosa Bacteriophytochrome
Class: signaling protein
Keywords: Photoreceptor, phytochrome, PAS, signaling, SIGNALING PROTEIN
Deposited on 2010-06-14, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhqa1, d3nhqa2, d3nhqa3
  • Chain 'B':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhqb1, d3nhqb2, d3nhqb3
  • Chain 'C':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhqc1, d3nhqc2, d3nhqc3
  • Chain 'D':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhqd1, d3nhqd2, d3nhqd3
  • Chain 'E':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhqe1, d3nhqe2, d3nhqe3
  • Chain 'F':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWR3 (Start-496)
      • expression tag (497)
    Domains in SCOPe 2.07: d3nhqf1, d3nhqf2, d3nhqf3, d3nhqf4
  • Chain 'G':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhqg1, d3nhqg2, d3nhqg3
  • Chain 'H':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhqh1, d3nhqh2, d3nhqh3
  • Heterogens: BLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nhqA (A:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqA (A:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwdccgvlairfhrqesgwifwfrheevhri
    rwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelcl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nhqB (B:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqB (B:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwdccgvlairfhrqesgwifwfrheevlti
    gpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelclnha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nhqC (C:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqC (C:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwgdccgvlairfhrqesgwifwfrheevhr
    irwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelcl
    nh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nhqD (D:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqD (D:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwdccgvlairfhrqesgwifwfrheevhri
    rwggkeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelclnh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nhqE (E:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqE (E:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwccgvlairfhrqesgwifwfrheevhrir
    wggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelcln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nhqF (F:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqF (F:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwdccgvlairfhrqesgwifwfrheevlti
    gpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelclnhal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3nhqG (G:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqG (G:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwdccgvlairfhrqesgwifwfrheevhri
    rwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelcln
    ha
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3nhqH (H:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhqH (H:)
    tpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqv
    gpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsft
    lnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredles
    ylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsvs
    pihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaive
    rleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtl
    sirgdferqagnvlqrlqrdperdiyhtdnwdccgvlairfhrqesgwifwfrheevhri
    rwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelcln
    h